KLK-B1 anticorps

N° du produit ABIN630229

Cet anticorps Lapin Polyclonal détecte spécifiquement dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour KLK-B1 anticorps (ABIN630229)

Antigène: KLK-B1

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Application: Western Blotting (WB)

Détail du produit

Purification: Purified

Immunogène: KLK-B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVS

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KLK-B1 Blocking Peptide, (ABIN5614387), is also available for use as a blocking control in assays to test for specificity of this KLK-B1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLKB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: KLK-B1

Sujet: Plasma prekallikrein is a glycoprotein that participates in the surface-dependent activation of blood coagulation, fibrinolysis, kinin generation and inflammation. It is synthesized in the liver and secreted into the blood as a single polypeptide chain. Plasma prekallikrein is converted to plasma kallikrein by factor XIIa by the cleavage of an internal Arg-Ile bond. Plasma prekallikrein deficiency causes a prolonged activated partial thromboplastin time in patients.

Poids moléculaire: 28 kDa (MW of target protein)